AV38141

Anti-MXD1 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

• Synonym(s): Anti-MAD, Anti-MAD1, Anti-MAX dimerization protein 1, Anti-MGC104659
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: lyophilized powder
• mol wt: 25 kDa
• species reactivity: zebrafish, mouse, rat, canine, chicken, bovine, human,
• technique(s): western blot: suitable
• immunogen sequence: AAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSK
• NCBI accession no.: NP_002348
• UniProt accession no.: Q05195
• storage temp.: −20°C
• Gene Information: human ... MXD1(4084)

Description

General description

MyC associated factor X (MAX), Myc and MAX dimerization protein 1 (Mad) are basic helix-loop-helix leucine zipper transcription factors that bind to a specific hexanucleotide element of DNA, the E-box (CACGTG). Myc and Mad form heterodimers with Max to become active regulators of transcription. Myc:Max and Mad:Max heterodimers form higher order complexes that regulate a wide range of cell processes at the level of transcription. Myc:Max and Mad:Max dimerizations are regulatory control points for many myc and mad mediated cell processes.

Specificity

Anti-MXD1 polyclonal antibody reacts with bovine, canine, zebrafish, human, mouse, rat, and chicken MAX dimerization protein 1 molecules.

Immunogen

synthetic peptide corresponding to a region of human MXD1 with an internal ID of S04807

Application

Anti-MXD1 polyclonal antibody is used to tag MAX dimerization protein 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of MAX dimerization protein 1 in regulation of transcription.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Safety Information

• Storage Class: 13 - Non Combustible Solids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable