The GATA zinc finger transcription factors are characterized by their ability to bind to the promoter region DNA sequence "GATA" within various genes. GATA4, prevalent in endoderm-derived organs, regulates various genes involved in embryogenesis and in myocardial differentiation and function.
The previously assigned protein identifier Q5IFM8 has been merged into P43694. Full details can be found on the UniProt database.
Specificity
Anti-GATA4 polyclonal antibody reacts with human, mouse, rat, pig, and canine GATA4 transcription factors.
Immunogen
Synthetic peptide directed towards the N terminal region of human GATA4
Application
Anti-GATA4 polyclonal antibody is used to tag GATA4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of GATA4 in the regulation of embryogenesis and differentiation primarily within endoderm-derived organs and tissues.
Biochem/physiol Actions
GATA4 is a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. GATA4is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects.
Sequence
Synthetic peptide located within the following region: MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
