Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV36236

Sigma-Aldrich

Anti-ZNF683 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Zinc finger protein 683

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$457.00

$457.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μL
$457.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$457.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZNF683(257101)

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF683

Biochem/physiol Actions

ZNF683 is a transcription factor characterized by the presence of Krüppel-associated boxes or KRAB domain. Zinc finger proteins have diverse functions that include activation of transcription, regulation of apoptosis, protein folding, RNA packaging and lipid binding. ZNF683 is a homolog of Blimp-1 that is expressed in mouse natural killer T cells.

Sequence

Synthetic peptide located within the following region: PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Klaas P J M van Gisbergen et al.
Nature immunology, 13(9), 864-871 (2012-08-14)
The transcriptional repressor Blimp-1 mediates the terminal differentiation of many cell types, including T cells. Here we identified Hobit (Znf683) as a previously unrecognized homolog of Blimp-1 that was specifically expressed in mouse natural killer T cells (NKT cells). Through
J H Laity et al.
Current opinion in structural biology, 11(1), 39-46 (2001-02-17)
Zinc finger proteins are among the most abundant proteins in eukaryotic genomes. Their functions are extraordinarily diverse and include DNA recognition, RNA packaging, transcriptional activation, regulation of apoptosis, protein folding and assembly, and lipid binding. Zinc finger structures are as
C D Constantinou-Deltas et al.
Genomics, 12(3), 581-589 (1992-03-01)
The zinc finger motif is a highly conserved tandemly repeated sequence of 28-30 amino acids that was first identified in transcription factor TFIIIA from Xenopus laevis. Subsequently, similar motifs were found and characterized in many genes from mammalian genomes and

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service