Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV36036

Sigma-Aldrich

Anti-LASS4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CerS4, Anti-FLJ12089, Anti-LAG1 homolog, ceramide synthase 4, Anti-Trh1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

46 kDa

species reactivity

human, rat, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

Storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LASS4(79603)

Immunogen

Synthetic peptide directed towards the C terminal region of human LASS4

Biochem/physiol Actions

LASS4 or CERS4 is a ceramide synthase that are involved in the biosynthesis of ceramides, the key players in intracellular signaling that results in apoptosis, senescence, growth and proliferation. Increased activity of CERS4 has been reported in breast cancer cells and results in induction of apoptosis. The expression of CERS4 is increased in pancreatic β-cells in response to glucotoxicity.

Sequence

Synthetic peptide located within the following region: MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yichang Liu et al.
Lipids in health and disease, 23(1), 68-68 (2024-03-03)
Stress is implicated in various pathological conditions leading to liver injury. Existing evidence suggests that excessive stress can induce mitochondrial damage in hepatocytes, yet the underlying mechanism remains unclear. Ceramide synthase 6 (CerS6)-derived C16:0 ceramide is recognised as a lipotoxic
Daniela Hartmann et al.
The international journal of biochemistry & cell biology, 44(4), 620-628 (2012-01-11)
Ceramides are known to be key players in intracellular signaling and are involved in apoptosis, cell senescence, proliferation, cell growth and differentiation. They are synthesized by ceramide synthases (CerS). So far, six different mammalian CerS (CerS1-6) have been described. Recently
Julien Véret et al.
The Biochemical journal, 438(1), 177-189 (2011-05-20)
Pancreatic β-cell apoptosis induced by palmitate requires high glucose concentrations. Ceramides have been suggested to be important mediators of glucolipotoxicity-induced β-cell apoptosis. In INS-1 β-cells, 0.4 mM palmitate with 5 mM glucose increased the levels of dihydrosphingosine and dihydroceramides, two

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service