AV35765
Anti-HMGB3 (AB1) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-High-mobility group box 3
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$457.00
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(1)
Select a Size
Change View
100 μL
$457.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
23 kDa
species reactivity
horse, rabbit, human, dog, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HMGB3(3149)
Immunogen
Synthetic peptide directed towards the C terminal region of human HMGB3
Biochem/physiol Actions
HMGB3 belongs to high mobility group of proteins and contains HMG box domain that binds DNA. It plays a critical role in DNA replication, nucleosome assembly and transcription. HMGB3 reportedly regulates cell proliferation, migration and invasion of B cells and gastric cancer cells.
Sequence
Synthetic peptide located within the following region: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yuanyuan Xie et al.
Cancer management and research, 12, 6827-6836 (2020-08-18)
The high expression of circular RNA circEPSTI1 (hsa_circRNA_000479) has been reported to be associated with the malignant potential of ovarian cancer cells and triple-negative breast cancer cells. However, the expression profile and function of circEPSTI1 in non-small cell lung cancer
Circ_LDLR promotes the progression of papillary thyroid carcinoma by regulating miR-1294/HMGB3 axis.
Guo Chen et al.
Journal of biochemical and molecular toxicology, 37(12), e23498-e23498 (2023-08-11)
Circular RNAs (circRNAs) have been found to be associated with the development and progression of cancers including papillary thyroid carcinoma (PTC). Circ_LDLR has been reported to be highly expressed in PTC, but its underlying mechanism of action has not been
Michael J Nemeth et al.
Blood, 102(4), 1298-1306 (2003-04-26)
Hmgb3 is a member of a family of chromatin-binding proteins that can alter DNA structure to facilitate transcription factor binding. We identified the Hmgb3 cDNA in a subtractive hybridization screen for transcripts that are preferentially expressed in hematopoietic stem cells.
Kai Yin et al.
IUBMB life, 72(11), 2508-2524 (2020-09-13)
Circular RNAs (circRNAs) are non-coding RNAs that have shown to regulate the progression of human diseases, including a variety of cancers. We aimed to investigate the function and the underlying working mechanism of circRNA matrix metallopeptidase 1 (circMMP1; hsa_circ_0024108) in
Y Gong et al.
Genetics and molecular research : GMR, 12(4), 6032-6039 (2013-12-18)
Gastric cancer is a major health problem worldwide; it is the second most common cause of cancer death in the world. Recent studies indicate that the high-mobility group (HMG) of chromosomal proteins is associated with cancer progression. However, HMGB3 has
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
