Paired-like homeodomain transcription factor 2 (PITX2) also known as pituitary homeobox 2 is a homeodomain transcription factor that regulates expression of genes critical for proper eye, tooth and abdominal organ development as well as expression of pituitary-specific genes including prolactin. Mutations in PITX2 cause Axenfeld-Rieger syndrome.
Immunogen
The immunogen for anti-PITX2 antibody: synthetic peptide derected towards the N terminal of human PITX2
Sequence
Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The homeodomain transcription factor, PITX2 is associated with tumorigenesis of multiple cancers. In this research, we aimed to study the expression, function and mechanism of PITX2 in lung adenocarcinoma (LUAD). The TCGA dataset was used to analyze the expression and
Molecular and cellular endocrinology, 140(1-2), 31-36 (1998-08-29)
A subfamily of bicoid-related homeodomain factors was recently discovered through its involvement in transcription of pituitary-specific genes. We isolated the first member of this family, Ptxl (pituitary homeobox 1), through its DNA binding properties whereas a second related gene, Ptx2
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
