AV35152
Anti-ACCN3 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Amiloride-sensitive cation channel 3
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
58 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
Storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ACCN3(9311)
General description
ACCN3 (ASIC3) belongs to the degenerin/epithelial sodium channel (DEG/ENaC) protein family. It is known to function as an acid sensor, as well as a sensor of acidic and inflammatory pain. It is also known to enhance H+ gated currents in neurons. ASIC3 has been implicated in ischemic pain and hyperalgesia.
Rabbit Anti-ACCN3 antibody recognizes human, mouse, rat, bovine, and canine ACCN3.
Rabbit Anti-ACCN3 antibody recognizes human, mouse, rat, bovine, and canine ACCN3.
Immunogen
Synthetic peptide directed towards the N terminal region of human ACCN3
Application
Rabbit Anti-ACCN3 antibody is suitable for western blot (2.5 μg/ml) and IHC (4-8 μg/ml) applications.
Biochem/physiol Actions
ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
Sequence
Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Junichi Yagi et al.
Circulation research, 99(5), 501-509 (2006-07-29)
Acid-sensing ion channel 3 (ASIC3) is highly expressed on sensory neurons that innervate heart and skeletal muscle and, therefore, is proposed to detect lactic acidosis and to transduce angina and muscle ischemic pain. A difficulty with this idea is that
Jinghui Xie et al.
Journal of neurophysiology, 89(5), 2459-2465 (2003-03-04)
The acid-sensing ion channels (ASICs) form cation channels that are transiently activated by extracellular protons. They are expressed in dorsal root ganglia (DRG) neurons and in the periphery where they play a function in nociception and mechanosensation. Previous studies showed
Emmanuel Deval et al.
The EMBO journal, 27(22), 3047-3055 (2008-10-17)
Acid-sensing ion channels (ASICs) are cationic channels activated by extracellular acidosis that are expressed in both central and peripheral nervous systems. Although peripheral ASICs seem to be natural sensors of acidic pain (e.g., in inflammation, ischaemia, lesions or tumours), a
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
