AV34981
Anti-GABRA3 (AB1) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-γ-Aminobutyric acid (GABA) A receptor, α 3
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$457.00
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(2)
Select a Size
Change View
100 μL
$457.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
55 kDa
species reactivity
mouse, guinea pig, horse, human, rabbit, dog, rat, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GABRA3(2556)
General description
GABRA3 codes for the GABAA receptor α3 subunit. Genetic varaiations in GABRA3 have been linked to behavioural despair, bipolar affective disorders and thyrotoxic hypokalaemic periodic paralysis.
Rabbit Anti-GABRA3 antibody recognizes bovine, human, mouse, rat, and canine GABRA3.
Rabbit Anti-GABRA3 antibody recognizes bovine, human, mouse, rat, and canine GABRA3.
Immunogen
Synthetic peptide directed towards the middle region of human GABRA3
Application
Rabbit Anti-GABRA3 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Sequence
Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
I Massat et al.
Molecular psychiatry, 7(2), 201-207 (2002-02-13)
The available data from preclinical and pharmacological studies on the role of gamma amino butyric acid (GABA) support the hypothesis that a dysfunction in brain GABAergic system activity contributes to the vulnerability to bipolar affective disorders (BPAD). Moreover, the localization
Wallaya Jongjaroenprasert et al.
Clinical endocrinology, 68(4), 646-651 (2007-11-01)
Genetic predisposition has been suggested to play role in the pathogenesis of thyrotoxic hypokalaemic periodic paralysis (THPP). In this study, we assessed the differences of single-nucleotide polymorphisms (SNP) allelic frequency between THPP patients and well-characterized controls in order to find
Brooke H Miller et al.
Mammalian genome : official journal of the International Mammalian Genome Society, 21(5-6), 247-257 (2010-06-01)
The Tail Suspension Test (TST), which measures behavioral despair, is widely used as an animal model of human depressive disorders and antidepressant efficacy. In order to identify novel genes involved in the regulation of TST performance, we crossed an inbred
Courtney Clyburn et al.
American journal of physiology. Gastrointestinal and liver physiology, 317(1), G40-G50 (2019-05-03)
Perinatal high-fat diet (pHFD) exposure increases the inhibition of dorsal motor nucleus of the vagus (DMV) neurons, potentially contributing to the dysregulation of gastric functions. The aim of this study was to test the hypothesis that pHFD increases the inhibition
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
