The previously assigned protein identifier Q76LB3 has been merged into Q8TB24. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human RIN3
Application
Rabbit Anti-RIN3 antibody is suitable for western blot applications at a concentration of 5 μg/ml.
Biochem/physiol Actions
RIN3, biochemically characterized as the stimulator and stabilizer for GTP-Rab5, plays an important role in the transport pathway from plasma membrane to early endosomes.
Sequence
Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.