EGL-9 family hypoxia-inducible factor 1 (EGLN1) is a protein that catalyzes 4-hydroxyproline formation in hypoxia-inducible factor (HIF) alpha proteins. Studies have reported that EGLN1 reacts with nitric oxide and modulates hypoxic responses. EGLN1 polymorphisms have been linked to high altitude sickness. Rabbit Anti-EGLN1 antibody recognizes canine, human, mouse, rat, and zebrafish EGLN1.
Immunogen
Synthetic peptide directed towards the C terminal region of human EGLN1
Application
Rabbit Anti-EGLN1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Biochem/physiol Actions
EGLN1 has a role in the regulation of hypoxia-inducible factor. It is not affected by overexpression or downregulation of HIF-2alpha.
Sequence
Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of molecular biology, 410(2), 268-279 (2011-05-24)
The hypoxic response in animals is mediated via the transcription factor hypoxia-inducible factor (HIF). An oxygen-sensing component of the HIF system is provided by Fe(II) and 2-oxoglutarate-dependent oxygenases that catalyse the posttranslational hydroxylation of the HIF-α subunit. It is proposed
High altitude sickness (HAS) occurs among humans visiting or inhabiting high altitude environments. Genetic differences in the EPAS1 and EGLN1 genes have been found between lowland (Han) and highland (Tibetan) Chinese. Three SNPs within EPAS1 and EGLN1 were evaluated in
Proceedings of the National Academy of Sciences of the United States of America, 107(44), 18961-18966 (2010-10-20)
It is being realized that identification of subgroups within normal controls corresponding to contrasting disease susceptibility is likely to lead to more effective predictive marker discovery. We have previously used the Ayurvedic concept of Prakriti, which relates to phenotypic differences
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
