C14ORF166 (CLE) is known to interact with influenza virus polymerase and HCV (Hepatitis C Virus) core protein during viral replication and assembly. Rabbit Anti-C14ORF166 antibody recognizes bovine, human, mouse, rat, and canine C14ORF166.
Immunogen
Synthetic peptide directed towards the N terminal region of human C14orf166
Application
Rabbit Anti-C14ORF166 antibody is suitable for western blot applications at a concentration of 0.125 μg/ml.
Biochem/physiol Actions
The function of the C14orf266 gene has not yet been determined.
Sequence
Synthetic peptide located within the following region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of virology, 85(22), 12062-12066 (2011-09-09)
The influenza A virus polymerase associates with a number of cellular transcription-related factors, including RNA polymerase II. We previously described the interaction of influenza virus polymerase subunit PA with human CLE/C14orf166 protein (hCLE), a positive modulator of this cellular RNA
Journal of proteome research, 10(10), 4522-4534 (2011-08-10)
The hepatitis C virus core protein (HCVc) forms the viral nucleocapsid and is involved in viral persistence and pathogenesis, possibly by interacting with host factors to modulate viral replication and cellular functions. Here, we identified 36 cellular protein candidates by
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.