FLJ37300 is a Kinesin-like protein also known as KIF19. It has a molecular weight of 111 kDa and is expressed with the cytoskeleton.
The previously assigned protein identifier Q8N1X8 has been merged into Q2TAC6. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human FLJ37300
Biochem/physiol Actions
FLJ37300 is a hypothetical protein found on chromosome 17.
Sequence
Synthetic peptide located within the following region: EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Proceedings of the National Academy of Sciences of the United States of America, 98(13), 7004-7011 (2001-06-21)
Intracellular transport is essential for morphogenesis and functioning of the cell. The kinesin superfamily proteins (KIFs) have been shown to transport membranous organelles and protein complexes in a microtubule- and ATP-dependent manner. More than 30 KIFs have been reported in
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
