AV32586

Anti-HIPK2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Homeodomain interacting protein kinase 2, Anti-PRO0593
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 120 kDa
• species reactivity: guinea pig, rat, dog, human, horse, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_073577
• UniProt accession no.: Q9H2X6
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HIPK2(28996)

Description

Immunogen

Synthetic peptide directed towards the middle region of Human HIPK2

Biochem/physiol Actions

HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.

Sequence

Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable