MKX is a homeobox protein that belongs to the IRX family. This protein may modulate the development of tendons in mice. Rabbit Anti-MKX (AB2) antibody recognizes zebrafish, human, chicken, canine, rat, bovine, and mouse MKX.
Immunogen
Synthetic peptide directed towards the middle region of human MKX
Application
Rabbit Anti-MKX can be used for western blot (0.25μg/ml) and IHC (4-8μg/ml) applications.
Biochem/physiol Actions
MKX contains 1 homeobox DNA-binding domain and belongs to the TALE/IRO homeobox family. It may act as a morphogenetic regulator of cell adhesion.
Sequence
Synthetic peptide located within the following region: IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
