Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

AV32473

Sigma-Aldrich

Anti-TAF1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BA2R, Anti-CCG1, Anti-CCGS, Anti-DYT3, Anti-KAT4, Anti-NSCL2, Anti-OF, Anti-TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250 kDa

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$493.00

$493.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
$493.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$493.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

215 kDa

species reactivity

bovine, dog, rat, pig, human, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

ChIP: suitable
immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TAF1(6872)

General description

TAF1 is a transcription factor that is associated with TATA-binding proteins. It interacts with GCN5 and HD1 and facilitates the histone acetylation needed for light-induced genetic responses.
Rabbit Anti-TAF1 antibody recognizes canine, human, mouse, and rat TAF1.

Immunogen

Synthetic peptide directed towards the C terminal region of human TAF1

Application

Rabbit Anti-TAF1 antibody has been used for western blotting applications at 0.5μg/ml.

Biochem/physiol Actions

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Udaiyappan Janakiraman et al.
Neurobiology of disease, 132, 104539-104539 (2019-07-26)
TAF1/MRSX33 intellectual disability syndrome is an X-linked disorder caused by loss-of-function mutations in the TAF1 gene. How these mutations cause dysmorphology, hypotonia, intellectual and motor defects is unknown. Mouse models which have embryonically targeted TAF1 have failed, possibly due to
Moussa Benhamed et al.
The Plant cell, 18(11), 2893-2903 (2006-11-07)
We previously showed that Arabidopsis thaliana histone acetyltransferase TAF1/HAF2 is required for the light regulation of growth and gene expression, and we show here that histone acetyltransferase GCN5 and histone deacetylase HD1/HDA19 are also involved in such regulation. Mutation of

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service