NEUROD6 is a basic helix-loop-helix (bHLH) transcription factor that belongs to the NeuroD subfamily of proteins. This transcription factor is regulated by promoters through CRE and C/EBP binding sites. Studies have reported that NeuroD6 defines novel retinal amacrine cells and modulates their fate. Rabbit Anti-NEUROD6 (AB1) antibody recognizes canine, human, mouse, rat, bovine, and chicken NEUROD6.
Immunogen
Synthetic peptide directed towards the N terminal region of human NEUROD6
Application
Rabbit Anti-NEUROD6 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Sequence
Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of neuroscience research, 85(1), 1-18 (2006-11-01)
Expression of the bHLH transcription factor Nex1/MATH-2/NeuroD6, a member of the NeuroD subfamily, parallels overt neuronal differentiation and synaptogenesis during brain development. Our previous studies have shown that Nex1 is a critical effector of the NGF pathway and promotes neuronal
Most regions of the CNS contain many subtypes of inhibitory interneurons with specialized roles in circuit function. In the mammalian retina, the ∼30 subtypes of inhibitory interneurons called amacrine cells (ACs) are generally divided into two groups: wide/medium-field GABAergic ACs
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.