TLE-2 is the human homolog of Drosophila E(sp1) that interacts with the replication and transcription activator (RTA) protein. Studies have reported that TLE2 can block RTA-mediated transactivation and replication. Rabbit Anti-TLE2 antibody recognizes human, mouse, and rat TLE2
Immunogen
Synthetic peptide directed towards the N terminal region of human TLE2
Application
Rabbit Anti-TLE2 antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
TLE2 belongs to the WD repeat Groucho/TLE family. It contains 6 WD repeats. TLE2 is a transcriptional corepressor that binds to a number of transcription factors. It inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.
Sequence
Synthetic peptide located within the following region: VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of virology, 84(4), 2047-2062 (2009-11-27)
Replication and transcription activator (RTA) encoded by open reading frame 50 (ORF50) of Kaposi's sarcoma-associated herpesvirus (KSHV) is essential and sufficient to initiate lytic reactivation. RTA activates its target genes through direct binding with high affinity to its responsive elements
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.