RNF12 is known to modulate the inactivation of X chromosome in mouse embryonic stem (ES) cells. RNF12 can target Smad7 for degradation, and regulate the cell fate and morphogenesis in zebrafish embryos. Rabbit Anti-RNF12 antibody recognizes human, canine, mouse, chicken, bovine, and rat RNF12.
Immunogen
Synthetic peptide directed towards the C terminal region of human RNF12
Application
Rabbit Anti-RNF12 antibody can be used for western blot applications at a concentration of 2μg/ml. It can also be used for IHC assays at 4-8μg/ml using paraffin-embedded tissues.
Biochem/physiol Actions
RNF12 is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.
Sequence
Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
TGF-β members are of key importance during embryogenesis and tissue homeostasis. Smad7 is a potent antagonist of TGF-β family/Smad-mediated responses, but the regulation of Smad7 activity is not well understood. We identified the RING domain-containing E3 ligase RNF12 as a
In somatic cells of female placental mammals, one X chromosome is inactivated to minimize sex-related dosage differences of X-encoded genes. Random X chromosome inactivation (XCI) in the embryo is a stochastic process, in which each X has an independent probability
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
