PBX3 is a homeobox transcription factor that shares homology with the human proto-oncogene, PBX1. It is known to enhance the transcriptional functions of HOX proteins and can also modulate developmental genes. Furthermore, PBX1 can regulate cell proliferation and has been implicated in gastric cancer. Rabbit Anti-PBX3 antibody recognizes human, mouse, rat, bovine, chicken, and zebrafish PBX3.
Immunogen
Synthetic peptide directed towards the N terminal region of human PBX3
Application
Rabbit Anti-PBX3 antibody can be used for western blot applications at a concentration of 2.5μg/ml.
Biochem/physiol Actions
PBX3 is a transcriptional activator that binds the sequence 5′-ATCAATCAA-3′.
Sequence
Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 35(5), 4363-4368 (2014-01-01)
The pre-leukemia transcription factor 3 (PBX3) is a member of the PBX family of transcription factors, which is known to increase DNA-binding/transcriptional activity of HOX proteins and regulate genes involved in development. Recently, PBX3 was reported to be involved in
Molecular and cellular biology, 11(12), 6149-6157 (1991-12-01)
Two new homeobox genes, PBX2 and PBX3, were isolated on the basis of their extensive homology to PBX1, a novel human homeobox gene involved in t(1;19) translocation in acute pre-B-cell leukemias. The predicted Pbx2 and Pbx3 proteins are 92 and
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.