BARHL2 is a homeobox transcription factor that regulates neuronal dI1 subtype diversification in the developing spinal cord. Rabbit Anti-BARHL2 antibody recognizes rat, human, and mouse BARHL2.
Immunogen
Synthetic peptide directed towards the middle region of human BARHL2
Application
Rabbit Anti-BARHL2 antibody can be used for western blot applications at a concentration of 0.05-2.0μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.
Biochem/physiol Actions
BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.
Sequence
Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Proceedings of the National Academy of Sciences of the United States of America, 109(5), 1566-1571 (2012-02-07)
In the dorsal spinal cord, distinct interneuron classes relay specific somatosensory information, such as touch, heat, and pain, from the periphery to higher brain centers via ipsilateral and contralateral axonal pathways. The transcriptional mechanisms by which dorsal interneurons choose between
The Journal of neuroscience : the official journal of the Society for Neuroscience, 36(36), 9454-9471 (2016-09-09)
All tissues are genetically programmed to acquire an optimal size that is defined by total cell number and individual cellular dimensions. The retina contains stereotyped proportions of one glial and six neuronal cell types that are generated in overlapping waves.
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
