ZNF297B is zinc finger protein that interacts with the BDP1 subunit of TFIIIB. Rabbit Anti-ZNF297B (AB2) recognizes bovine, mouse, rat, canine, chicken, and human ZNF297B.
Immunogen
Synthetic peptide directed towards the N terminal region of human ZNF297B
Application
Rabbit Anti-ZNF297B (AB2) can be used for western blot applications at a dilution of 5μg/ml.
Biochem/physiol Actions
ZNF297B is a candidate transcription factor
Sequence
Synthetic peptide located within the following region: LVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The human gene BDP1, localized on chromosome 5q13 in close proximity to the spinal muscular atrophy determining gene SMN, encodes a large protein consisting of 2254 amino acids (aa). In the first third of the gene, the subunit of the
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.