AV31708

Anti-ZNF609 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Zinc finger protein 609
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 155 kDa
• species reactivity: rat, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_055857
• UniProt accession no.: O15014
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZNF609(23060)

Description

General description

ZNF609 is a zinc-finger protein that may function as a p53-regulated target.
Rabbit Anti-ZNF609 antibody recognizes chicken, human, bovine, mouse, and rat ZNF609.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF609

Application

Rabbit Anti-ZNF609 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Biochem/physiol Actions

The function of ZNF609 remains unknown.

Sequence

Synthetic peptide located within the following region: NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable