AV31676
Anti-ZNFN1A2 antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$457.00
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(2)
Select a Size
Change View
100 μL
$457.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$457.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
43 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ZNFN1A2(22807)
General description
Helios/IKAROS family zinc finger 2 (ANF1A2, ZNF1A2, ZNFN1A2), a member of the Ikaros family of zinc-finger transcription factors, is a hematopoietic-specific transcription factors involved in the regulation of early lymphocyte development. Helios can form homodimers and heterodimers with other Ikaros family members to differentially regulate hematopoietic development.
Rabbit polyclonal anti-ZNFN1A2 antibody reacts with human, mouse, rat, chicken, and canine Helios/IKAROS family zinc finger 2 transcription factors.
Studies have reported that ZNFN1A2 has been deregulated in human leukemias.
Immunogen
Synthetic peptide directed towards the C terminal region of human ZNFN1A2
Application
Rabbit anti-ZNFN1A2 can be used for western blot (5.0μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) applications.
Rabbit polyclonal anti-ZNFN1A2 antibody is used to tag helios/IKAROS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of helios/IKAROS family zinc finger 2 in early onset regulation of lymphocyte development.
Biochem/physiol Actions
Novel short isoforms of this gene, ZNFN1A2, are overexpressed in a patient with T-cell acute lymphoblastic leukemia and may contribute to the development of T-cell malignancies.
Sequence
Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Angelita Rebollo et al.
Immunology and cell biology, 81(3), 171-175 (2003-05-20)
Ikaros, Aiolos and Helios encode zinc finger transcription factors that are important regulators of lymphoid development and differentiation. These proteins are involved in the control of gene expression and when associated with nuclear complexes, participate in nucleosome remodeling. Because differential
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
