AV31648

Anti-LASS3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-LAG1 homolog, ceramide synthase 3 (S. cerevisiae)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 46 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_849164
• UniProt accession no.: Q8IU89
• shipped in: wet ice
• Storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LASS3(204219)

Description

General description

Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid protein.
Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.

Immunogen

Synthetic peptide directed towards the N terminal region of human LASS3

Application

Rabbit Anti-LASS3 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

The gene encoding the hypothetical protein LASS3 is located on chromosome 15.

Sequence

Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable