AV31323

Anti-TCEB2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-SIII, Anti-Transcription elongation factor B (SIII), polypeptide 2 (18 kDa, elongin B)
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 13 kDa
• species reactivity: pig, human, rabbit, bovine, rat, dog, goat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_009039
• UniProt accession no.: Q15370
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... TCEB2(6923)

Description

General description

TCEB2 codes for elongin B which forms a regulatory component of the transcription factor B (SIII) complex. The SIII complex is known to inhibit transient pausing of RNA polymerase II, thereby facilitating transcriptional elongation.
Rabbit Anti-TCEB2 antibody recognizes zebrafish, bovine, human, mouse, and rat TCEB2.

Immunogen

Synthetic peptide directed towards the middle region of human TCEB2

Application

Rabbit Anti-TCEB2 antibody can be used for immunohistochemistry (4-8μg/ml) and western blot (0.25μg/ml) assays.

Biochem/physiol Actions

TCEB2 is the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Sequence

Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable