AV31175

Anti-E2F4 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-E2F transcription factor 4, p107/p130-binding
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 44 kDa
• species reactivity: mouse, rabbit, guinea pig, rat, bovine, dog, human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: 4-8 μg/mL (Paraffin-embedded Tissue); western blot: suitable
• NCBI accession no.: NP_001941
• UniProt accession no.: Q16254
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... E2F4(1874)

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human E2F4

Application

Rabbit Anti-E2F4 antibody can be used for western blot (2.0μg/ml) and IHC (4-8μg/ml) applications.

Biochem/physiol Actions

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins. It is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It also plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.

Sequence

Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable