Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV30313

Sigma-Aldrich

Anti-PDPK1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-3-Phosphoinositide dependent protein kinase-1, Anti-MGC20087, Anti-MGC35290, Anti-PDK1, Anti-PRO0461, Anti-PkB-like, Anti-PkB-like1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$493.00

$493.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μL
$493.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$493.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

bovine, horse, dog, rabbit, human, mouse, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PDPK1(5170)

General description

PDPK1 is a kinase that regulates several signaling pathways mediated by various hormones and growth factors. PDPK1 has been implicated in breast cancer metastasis and prostate cancer progression.
Rabbit Anti-PDPK1 antibody recognizes human, mouse, rat, zebrafish, and pig PDPK1.

Immunogen

Synthetic peptide directed towards the middle region of human PDPK1

Application

Rabbit Anti-PDPK1 antibody has been used for western blot assays at a concentration of 0.5μg/ml.

Biochem/physiol Actions

PDPK1 phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. It may play a general role in signaling processes and in development.

Sequence

Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Khalil A Choucair et al.
Translational oncology, 5(6), 453-460 (2013-02-13)
Prostate cancer (PCa) is a leading cause of cancer death, and distinguishing aggressive from indolent tumors is a major challenge. Identification and characterization of genomic alterations associated with advanced disease can provide new markers of progression and better therapeutic approaches.
Chanse Fyffe et al.
Cancer management and research, 5, 271-280 (2013-09-17)
It should be noted that 3-phosphoinositide-dependent protein kinase-1 (PDK1) is a protein encoded by the PDPK1 gene, which plays a key role in the signaling pathways activated by several growth factors and hormones. PDK1 is a crucial kinase that functions
Aaron Pitre et al.
Molecular biology of the cell, 23(7), 1243-1253 (2012-02-18)
The intermediate filament protein synemin is present in astrocyte progenitors and glioblastoma cells but not in mature astrocytes. Here we demonstrate a role for synemin in enhancing glioblastoma cell proliferation and clonogenic survival, as synemin RNA interference decreased both behaviors

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service