YEATS4 is an oncogene that negatively regulates the p21-p53 pathway. Amplification of YEATS4 has been linked to the pathogenesis of non-small cell lung cancers (NSCLC). Rabbit Anti-YEATS4 antibody recognizes chicken, bovine, zebrafish, canine, human, mouse, and ratYEATS4.
Immunogen
Synthetic peptide directed towards the middle region of human YEATS4
application
Rabbit Anti-YEATS4 antibody can be used for western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) assays.
Biochem/physiol Actions
YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Sequence
Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Genetic analyses of lung cancer have helped found new treatments in this disease. We conducted an integrative analysis of gene expression and copy number in 261 non-small cell lung cancers (NSCLC) relative to matched normal tissues to define novel candidate
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
