Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV15002

Sigma-Aldrich

Anti-KRT14 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$457.00

$457.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μL
$457.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$457.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

52 kDa

species reactivity

human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KRT14(3861)

Immunogen

Synthetic peptide directed towards the C terminal region of human KRT14

Application

Anti-KRT14 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

Keratins are abundantly present structural proteins in epithelial cells. Keratins 5 and 14 are primary structural proteins of stratifying epithelia. Mutations in K14 gene or defects in K5-K14 network results in Epidermolysis bullosa simplex, a condition characterized by superficial bullous lesions on skin epithelia.

Sequence

Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

E L Rugg et al.
Genes & development, 8(21), 2563-2573 (1994-11-01)
The importance of keratins and other intermediate filaments in the maintenance of tissue structure is emphasized by the discovery that many hereditary skin-blistering diseases are caused by mutations in keratin genes. Here, we describe a situation in which keratin 14
Pierre A Coulombe et al.
The Journal of clinical investigation, 119(7), 1784-1793 (2009-07-10)
Epidermolysis bullosa (EB) simplex is a rare genetic condition typified by superficial bullous lesions that result from frictional trauma to the skin. Most cases are due to dominantly acting mutations in either keratin 14 (K14) or K5, the type I
Pierre A Coulombe et al.
The Journal of investigative dermatology, 132(3 Pt 2), 763-775 (2012-01-27)
Epidermolysis bullosa simplex (EBS) is a rare genetic condition typified by superficial bullous lesions following incident frictional trauma to the skin. Most cases of EBS are due to dominantly acting mutations in keratin 14 (K14) or K5, the type I

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service