Skip to Content
MilliporeSigma
All Photos(2)

Documents

AV100830

Sigma-Aldrich

Anti-EVX1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Even-skipped homeobox 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

42 kDa

species reactivity

bovine, rat, canine, rabbit, human, guinea pig, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... EVX1(2128)

General description

Even-skipped homeobox 1 (EVX1) is a homeobox transcription factor involved in embryonic stem cell differentiation and embryogenesis. EVX1 has been shown to control ESC differentiation at least in part by repressing GOOSECOID expression.
Rabbit polyclonal anti-EVX1 antibody reacts with chicken, human, mouse, rat, canine, bovine, and rabbit Even-skipped homeobox 1 transcription factors.

Immunogen

The immunogen for anti-EVX1 antibody: synthetic peptide derected towards the N terminal of human EVX1

Application

Rabbit polyclonal anti-EVX1 antibody is used to tag Even-skipped homeobox 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Even-skipped homeobox 1 in the regulation of embryonic stem cell (ESC) differentiation and embryogenesis, especially within the region of the primitive streak. The antibody is suitable for western blotting at a concentration of 1-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Biochem/physiol Actions

EVX1 appears just prior to grastrulation in the region of ectoderm containing cells destined to be found in the primitive streak, where it may be involved in dorsoventral specification of mesodermal cell fate. EVX1 is believed to be a postmitotic determinant of V0 interneuron identity. The expression of genes regulated by EVX1 is crucial for the development of zebrafish fin dermoskeleton.

Sequence

Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Claus J Schulte et al.
Developmental dynamics : an official publication of the American Association of Anatomists, 240(5), 1240-1248 (2011-04-22)
The transcription factor Evx1 is expressed in the joints between individual lepidotrichia (bony ray) segments and at the distal tips of the lepidotrichia in developing zebrafish fins. It is also expressed in the apical growth zone in regenerating fins. However
L Moran-Rivard et al.
Neuron, 29(2), 385-399 (2001-03-10)
Interneurons in the ventral spinal cord are essential for coordinated locomotion in vertebrates. During embryogenesis, the V0 and V1 classes of ventral interneurons are defined by expression of the homeodomain transcription factors Evx1/2 and En1, respectively. In this study, we

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service