Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV100639

Sigma-Aldrich

Anti-FOS antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-v-fos FBJ murine osteosarcoma viral oncogene homolog

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

41 kDa

species reactivity

mouse, human, sheep, bovine, rat, dog, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOS(2353)

General description

c-Fos is an inducible transcription factor and a functional marker of activated neurons. It is induced in response to neurotransmitters and growth factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human FOS

Application

Anti-FOS produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

c-Fos is a trans-acting factor that does not directly bind DNA. It interacts with AP-1 transcription factor, a step that is prerequisite for c-Fos-mediated gene expression. The role of c-Fos has been studied in activation of neurons, oncogenesis and inflammation of bone and skin.

Sequence

Synthetic peptide located within the following region: CTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

K J Kovács
Neurochemistry international, 33(4), 287-297 (1998-12-05)
This article summarizes the achievements that have been accumulated about the role of c-Fos as a transcription factor and as a functional marker of activated neurons. Since its discovery, more than a decade ago, as an inducible immediate-early gene encoding
Rainer Zenz et al.
Arthritis research & therapy, 10(1), 201-201 (2008-01-30)
Activator protein 1 (AP-1) (Fos/Jun) is a transcriptional regulator composed of members of the Fos and Jun families of DNA binding proteins. The functions of AP-1 were initially studied in mouse development as well as in the whole organism through
R Chiu et al.
Cell, 54(4), 541-552 (1988-08-12)
Cell lines stably transfected with metal inducible, MT-fos chimeric genes were used to study the ability of the c-fos gene product, Fos, to act as a transcriptional trans-activator. In 3T3MTfos cells, induction of Fos expression led to specific trans-activation of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service