Akt kinases participate in multiple signal transduction pathways and important cellular processes such as proliferation, survival, migration and angiogenesis.
Immunogen
Synthetic peptide directed towards the N terminal region of human AKT1
Application
Anti-AKT1 antibody is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
Although upregulation of Akt1 activity is rarely reported in cancers, mutations in Akt1 gene have been identified in many malignancies. Akt1 regulates homologous recombination and maintains genetic stability in breast cancer cells.
Sequence
Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Current cancer drug targets, 13(3), 234-244 (2013-01-10)
AKT/PKB (Protein Kinase B) are central proteins mediating signals from receptor tyrosine kinases and phosphatidylinositol 3-kinase. AKT kinases are involved in a number of important cellular processes including cell proliferation and survival, cell size in response to nutrient availability, tumor
Endogenous replicative stress could be one trigger leading to tumor initiation: indeed, activation of the DNA damage response (DDR), considered the result of replicative stress, is observed in pre-cancerous cells; moreover, in hereditary breast cancers, almost all of the genes
The effects of maternal undernutrition during midgestation on muscle fiber histology, myosin heavy chain (MyHC) expression, methylation modification of myogenic factors, and the mammalian target of rapamycin (mTOR) signaling pathway in the skeletal muscles of prenatal and postnatal goats were
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
