AV03047
Anti-CDKN2B antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
15 kDa
species reactivity
human, pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CDKN2B(1030)
Immunogen
Synthetic peptide directed towards the middle region of human CDKN2B
Application
Anti-CDKN2B antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
CDKN2B has inhibitory effects on cell cycle progression. It binds to cyclin-dependent kinases and prevents their association with D-type cyclins. Methylation of CDKN2B has been associated with pathogenesis of pediatric myelodysplastic syndromes and in malignant hematopoiesis. Mutations in CDKN2B gene have been observed in malignant gliomas.
Sequence
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yanhong Liu et al.
Current opinion in genetics & development, 20(3), 239-244 (2010-03-10)
Recent advances in human genome studies have opened new avenues for the identification of susceptibility genes for many complex genetic disorders, especially in the field of rare cancers such as glioma. To date, eight glioma susceptibility loci have been identified
Utz Krug et al.
Oncogene, 21(21), 3475-3495 (2002-05-29)
Over the last decade, a growing number of tumor suppressor genes have been discovered to play a role in tumorigenesis. Mutations of p53 have been found in hematological malignant diseases, but the frequency of these alterations is much lower than
Miyoung Kim et al.
Acta haematologica, 130(2), 115-121 (2013-04-11)
Transcriptional repression of tumor suppressor genes is determined by the quantity of promoter hypermethylation. We analyzed the methylation quantity of CDKN2B in pediatric myelodysplastic syndromes (MDS). Quantitative measurement of CDKN2B methylation was performed in 25 pediatric MDS patients and 12
Moon-Taek Park et al.
Journal of biochemistry and molecular biology, 36(1), 60-65 (2003-01-25)
Cancer is frequently considered to be a disease of the cell cycle. As such, it is not surprising that the deregulation of the cell cycle is one of the most frequent alterations during tumor development. Cell cycle progression is a
Nerea Méndez-Barbero et al.
EBioMedicine, 46, 274-289 (2019-08-10)
Tumor necrosis factor-like weak inducer of apoptosis (Tnfsf12; TWEAK) and its receptor Fibroblast growth factor-inducible 14 (Tnfrsf12a; Fn14) participate in the inflammatory response associated with vascular remodeling. However, the functional effect of TWEAK on vascular smooth muscle cells (VSMCs) is
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service