BRCA1 has been identified as the susceptibility gene for breast and ovarian cancers. The protein encoded by this gene regulates normal embryonic growth. BRCA1 has also been implicated in prostate cancer. Rabbit Anti-BRCA1 antibody binds to human, rat, and canine BRCA1.
Immunogen
The immunogen for anti-BRCA1 antibody: synthetic peptide derected towards the N terminal of human BRCA1
Application
Rabbit Anti-BRCA1 antibody can be used for western blot (0.5μg/ml) and immunohistochemical (4-8μg/ml, using paraffin-embedded tissues) applications.
Sequence
Synthetic peptide located within the following region: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The breast cancer susceptibility gene BRCA1 on chromosome 17q21 encodes an 1863 amino acid protein that is important for normal embryonic development. Germline mutations of this gene are linked to a significantly increased lifetime risk for breast and/or ovarian cancer
Science (New York, N.Y.), 266(5182), 66-71 (1994-10-07)
A strong candidate for the 17q-linked BRCA1 gene, which influences susceptibility to breast and ovarian cancer, has been identified by positional cloning methods. Probable predisposing mutations have been detected in five of eight kindreds presumed to segregate BRCA1 susceptibility alleles.
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
