Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

APREST76958

Sigma-Aldrich

PrEST Antigen MATN1

Prestige Antigens™ Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):

CMP, CRTM

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352202

recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 26 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

REIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV

Ensembl | human accession no.

ENSG00000162510

UniProt accession no.

P21941

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... MATN1(4146)

General description

Matrilin 1 (MATN1) is also called the cartilage matrix protein (CMP) and is the major matrix component of cartilage. The gene encoding MATN1 is mapped to human chromosome 1p35.2.[1] Matrilin 1 (MATN1) encodes a protein of 52,000 Da and exists as trimer. It has von Willebrand factor A domain.[2] It is a glycoprotein and interacts with cartilage collagen fibrils.[3]

Application

Suitable as a blocking agent using corresponding antibodies.

Biochem/physiol Actions

Autoantibodies to Matrilin 1 (MATN1) is implicated in patients with autoimmune disorder, polychondritis.[4] MATN1 inhibits new capillary and blood vessel formation and could be used for treating diseases associated with improper neovascularization.[5] Mutations in MATN1 gene impacts the assembly process of collagen.[6] MATN1 gene polymorphisms result in spine deformity and is associated with familial idiopathic scoliosis [7]

Linkage

Corresponding Antibody HPA028580.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The matrilins-adaptor proteins in the extracellular matrix
Wagener R, et al.
Febs Letters, 579(15), 3323-3329 (2005)
Evidence of a linkage between matrilin-1 gene (MATN1) and idiopathic scoliosis
Montanaro L, et al.
Scoliosis and Spinal Disorders, 1(1), 21-21 (2006)
Abnormal collagen fibrils in cartilage of matrilin-1/matrilin-3-deficient mice
Nicolae C, et al.
The Journal of Biological Chemistry (2007)
Matrilin-1 is an inhibitor of neovascularization
Foradori M, et al.
The Journal of Biological Chemistry, jbc-M113 (2014)
The occurrence of autoantibodies to matrilin 1 reflects a tissue-specific response to cartilage of the respiratory tract in patients with relapsing polychondritis
Hansson A, et al.
Arthritis and Rheumatism, 44(10), 2402-2412 (2001)
View All Related Papers

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service