APREST71273

PrEST Antigen LRP4

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Synonym(s): MEGF7
• UNSPSC Code: 12352202

Properties

• recombinant: expressed in E. coli
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 32 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• immunogen sequence: IQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVCACPDEPDSQPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAP
• Ensembl | human accession no.: ENSG00000134569
• UniProt accession no.: O75096
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... LRP4(4038)

Description

General description

LRP4 (low-density lipoprotein receptor-related protein 4a) is also called the multiple epidermal growth factor-like domains 7 (MEGF7).[1] It is mapped to human chromosome 11p11.2.[2] Low-density lipoprotein receptor-related protein 4a (LRP4) has epidermal growth factor repeat domain and four β-propeller domains.[3]

Application

Suitable as a blocking agent using corresponding antibodies.

Biochem/physiol Actions

It modulates wnt signal transduction pathway.[4] It is crucial for development of limbs [5] and is essential for neuromuscular junction formation.[6] Mutations in the LRP4 gene is associated with Cenani-Lenz syndrome (CLS), a disorder with abnormal distal limb development.[2][7] Defective splicing of LRP4 leads to mulefoot disease.[1] Mutations in the β-propeller domains of LRP4 is implicated in congenital myasthenic syndromes, a disorder of nerve impulse transmission.[8]

Linkage

Corresponding Antibody HPA011934.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable