Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

APREST71273

Sigma-Aldrich

PrEST Antigen LRP4

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym(s):

MEGF7

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352202

recombinant

expressed in E. coli

assay

>80% (SDS-PAGE)

form

buffered aqueous solution

mol wt

predicted mol wt 32 kDa

purified by

immobilized metal affinity chromatography (IMAC)

concentration

≥0.5 mg/mL

immunogen sequence

IQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVCACPDEPDSQPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAP

Ensembl | human accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LRP4(4038)

General description

LRP4 (low-density lipoprotein receptor-related protein 4a) is also called the multiple epidermal growth factor-like domains 7 (MEGF7).[1] It is mapped to human chromosome 11p11.2.[2] Low-density lipoprotein receptor-related protein 4a (LRP4) has epidermal growth factor repeat domain and four β-propeller domains.[3]

Application

Suitable as a blocking agent using corresponding antibodies.

Biochem/physiol Actions

It modulates wnt signal transduction pathway.[4] It is crucial for development of limbs [5] and is essential for neuromuscular junction formation.[6] Mutations in the LRP4 gene is associated with Cenani-Lenz syndrome (CLS), a disorder with abnormal distal limb development.[2][7] Defective splicing of LRP4 leads to mulefoot disease.[1] Mutations in the β-propeller domains of LRP4 is implicated in congenital myasthenic syndromes, a disorder of nerve impulse transmission.[8]

Linkage

Corresponding Antibody HPA011934.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

LDL-receptor-related protein 4 is crucial for formation of the neuromuscular junction
Weatherbee SD, et al.
Development, 133(24), 4993-5000 (2006)
Novel splice mutation in LRP4 causes severe type of Cenani-Lenz syndactyly syndrome with oro-facial and skeletal symptoms
Afzal M, et al.
European Journal of Medical Genetics, 60(8), 421-425 (2017)
LRP4 third beta-propeller domain mutations cause novel congenital myasthenia by compromising agrin-mediated MuSK signaling in a position-specific manner
Ohkawara B, et al.
Human Molecular Genetics, 23(7), 1856-1868 (2013)
Multiple modes of Lrp4 function in modulation of Wnt beta-catenin signaling during tooth development
Ahn Y, et al.
Development, dev-150680 (2017)
Defective splicing of Megf7/Lrp4, a regulator of distal limb development, in autosomal recessive mulefoot disease
Johnson EB, et al.
Genomics, 88(5), 600-609 (2006)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service