Skip to Content
Merck
All Photos(2)

Key Documents

SAB2104271

Sigma-Aldrich

Anti-SPNS2, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DFNB115, Anti-SLC62A2, Anti-SLC63A2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

60 kDa

species reactivity

human, pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SPNS2(124976)

General description

The sphingolipid transporter 2/Spinster 2 (SPNS2) gene codes for a transporter of the sphingosine-1-phosphate (S1P) signaling lipid. SPNS2 is a multi-pass transmembrane protein, that belongs to the spinster (SPNS)/major facilitator superfamily (MFS) family. It has 12 transmembrane domains. SPNS2 mRNA is seen abundantly in the lung, stomach, and placenta. It is expressed at a moderate level in the cervix, small intestine, brain, skin, lymph node, and other tissues.

Immunogen

Synthetic peptide directed towards the N terminal region of human SPNS2

Application

Anti-SPNS2, (N-terminal) antibody produced in rabbit has been used in immunoblotting (1:1000)/(1:3,000).

Biochem/physiol Actions

The sphingolipid transporter 2/Spinster 2 (SPNS2) protein serves as a mediator to release intracellular sphingosine-1-phosphate (S1P) and thereby regulates S1P. It might play a role in embryogenesis. Members of MFS family regulates the homeostasis in the body by transporting sugars, amino acids, ions, intermediary metabolites, and other small molecules across membranes. Lack of SPNS2 results in a significant reduction in S1P plasma levels. It plays an important role in prostate cancer, inflammatory and autoimmune diseases, and liver fibrosis.

Sequence

Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

L Peltier et al.
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA, 29(8), 1905-1915 (2018-05-04)
We aimed to study the mechanisms involved in bone-related iron impairment by using the osteoblast-like MG-63 cell line. Our results indicate that iron impact the S1P/S1PR signalizing axis and suggest that iron can affect the S1P process and favor the
Isabelle Seidita et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 37(8), e23061-e23061 (2023-06-30)
Endometriosis is a chronic gynecological disease affecting ~10% women in the reproductive age characterized by the growth of endometrial glands and stroma outside the uterine cavity. The inflammatory process has a key role in the initiation and progression of the
Grzegorz Młynarczyk et al.
Journal of cellular biochemistry, 123(4), 819-829 (2022-02-22)
There is a host of evidence for the role of bioactive sphingolipids in cancer biology, and dysregulated sphingolipid metabolism was observed in many malignant tumors. The aim of the present study was to provide more detailed data on sphingolipid metabolism
Xiao Zhu et al.
Molecular immunology, 103, 55-62 (2018-09-10)
Sphingosine-1-phosphate (S1P), a bioactive metabolite of sphingolipid, has an important role in lymphocyte trafficking, immune responses, vascular and embryonic development, cancer, bone homeostasis, etc. S1P is produced intracellularly and then secreted into the circulation to engage in the above physiological
Olivier Blanchard et al.
International journal of molecular sciences, 19(5) (2018-05-19)
Sphingosine kinase (SK) catalyses the formation of sphingosine 1-phosphate (S1P), which acts as a key regulator of inflammatory and fibrotic reactions, mainly via S1P receptor activation. Here, we show that in the human renal proximal tubular epithelial cell line HK2

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service