Skip to Content
Merck
All Photos(5)

Key Documents

HPA024386

Sigma-Aldrich

Anti-CD55 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CD55 antigen, Anti-Complement decay-accelerating factor

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CD55(1604)

General description

Decay accelerating factor (DAF)/complement decay-accelerating factor (CD55) is a cell associated C3 and C5 convertase regulator made of 4 tandem repeats (~60 amino acid long) known as short consensus repeats (SCRs) or complement control repeats (CCPs). It is a glycosylphosphatidylinositol (GPI)-anchored protein widely scattered among hematopoietic and nonhematopoietic cells. CD55 is located on human chromosome 1.

Immunogen

Complement decay-accelerating factor Precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-CD55 antibody has been used in immunohistochemistry and in the evaluation of the specificity of the anti-DAF (decay accelerating factor) antibody.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Decay accelerating factor (DAF)/complement decay-accelerating factor (CD55) regulates adaptive T cell responses. It serves as a receptor for the invasion of human RBCs by malaria parasites. It modulates the complement cascade on the cell surface. It also transfers the antigen determinants for the Cromer blood group system (CROM).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78248

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

DAF in diabetic patients is subject to glycation/inactivation at its active site residues.
Fluckiger R, et al.
Molecular Immunology, 93, 246-252 (2018)
Generation of a Felinized Swine Endothelial Cell Line by Expression of Feline Decay-Accelerating Factor.
Izuhara L, et al.
PLoS ONE, 10(2), e0117682-e0117682 (2015)
F Cimmino et al.
Oncogenesis, 5, e212-e212 (2016-04-05)
CD55 has been revealed to have an important role in tumor genesis, and presence of small populations of cells with strong CD55 expression would be sufficient to predict poor prognosis of several tumors. In our study we revealed that CD55
Lack of Association of CD55 Receptor Genetic Variants and Severe Malaria in Ghanaian Children.
Schuldt K, et al.
G3 (Bethesda, Md.), 7(3), 859?864-859?864 (2017)
CD55 is a HIF-2α marker with anti-adhesive and pro-invading properties in neuroblastoma.
Cimmino F, et al.
Oncogenesis, 5(4), e212-e212 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service