HPA001654

Anti-APOH antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-β-2-Glycoprotein I antibody produced in rabbit, Anti-β₂-GPI antibody produced in rabbit, Anti-β₂-Glycoprotein 1 precursor antibody produced in rabbit, Anti-β₂-Glycoprotein I antibody produced in rabbit, Anti-APC inhibitor antibody produced in rabbit, Anti-Activated protein C-binding protein antibody produced in rabbit, Anti-Anticardiolipin cofactor antibody produced in rabbit, Anti-Apo-H antibody produced in rabbit, Anti-Apolipoprotein H antibody produced in rabbit, Anti-B2GPI antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA001654
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: independent; independent; RNAi knockdown; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• immunogen sequence: ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK
• UniProt accession no.: P02749
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... APOH(350)

Description

General description

APOH (apolipoprotein H, β-2-glycoprotein I) is a single chain polymorphic glycoprotein involved in phospholipid binding interactions on platelets. It exists in plasma both in a free form and in combination with lipoprotein particles. It contains 11 disulfide bridges and four N-linked glycosylation sites with molecular mass of ~43kDa. It comprises of four short consensus repeat (SCRs) from the complement control protein (CCP) module type and an extra fifth C-terminal domain.

Immunogen

β₂-Glycoprotein 1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

APOH (apolipoprotein H, β-2-glycoprotein I) is associated with a variety of physiological pathways, including blood coagulation and immune response. It plays an essential role as a cofactor for the binding of certain antiphospholipid antibodies (APA) to anionic phospholipid. It consists of a positively charged lysine-rich domain which binds to negatively charged surfaces including heparin, DNA, cell membranes, endothelial cells,macrophages and acidic phospholipids.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84509

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves