Skip to Content
Merck
All Photos(3)

Key Documents

WH0026468M1

Sigma-Aldrich

Monoclonal Anti-LHX6 antibody produced in mouse

clone 3D9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-LHX6.1, Anti-LIM homeobox 6, Anti-MGC119542, Anti-MGC119544, Anti-MGC119545

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
R 8 833,72

R 8 833,72

List PriceR 9 014,00

Please contact Customer Service for Availability


Select a Size

Change View
100 μG
R 8 833,72

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

R 8 833,72

List PriceR 9 014,00

Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3D9, monoclonal

form

buffered aqueous solution

species reactivity

rat, mouse, human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... LHX6(26468)

General description

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. (provided by RefSeq)

Immunogen

LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

J Alberto Ortega et al.
Cerebral cortex (New York, N.Y. : 1991), 27(7), 3736-3751 (2016-09-08)
The oxygen (O2) concentration is a vital parameter for controlling the survival, proliferation, and differentiation of neural stem cells. A prenatal reduction of O2 levels (hypoxia) often leads to cognitive and behavioral defects, attributable to altered neural development. In this
Nevena V Radonjić et al.
Cerebral cortex (New York, N.Y. : 1991), 26(1), 131-143 (2014-08-26)
Impaired sonic hedgehog (Shh) signaling is involved in the pathology of cortical formation found in neuropsychiatric disorders. However, its role in the specification of human cortical progenitors is not known. Here, we report that Shh is expressed in the human

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service