Skip to Content
Merck
All Photos(1)

Key Documents

WH0004647M1

Sigma-Aldrich

Monoclonal Anti-MYO7A antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DFNA11, Anti-DFNB2, Anti-MYU7A, Anti-NSRD2, Anti-USH1B, Anti-myosin VIIA

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MYO7A(4647)

General description

MYO7A (myosin VIIA) or HM7A consists of 5 isoleucine-glutamine (IQ) motifs. It is present in retinal epithelial cells. It also interacts with other USH1 (Usher syndrome type 1B) gene products like harmonin and sans. This gene is located on human chromosome 11q13.

Immunogen

MYO7A (NP_000251, 2118 a.a. ~ 2213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS

Biochem/physiol Actions

MYO7A (myosin VIIA) or HM7A is involved in anchoring and holding membrane-bound elements to the actin core of the stereocilium. It acts as a transporter. This protein may participate in the tethering of melanosomes at the root of actin bundles. HM7A is responsible for Usher syndrome type 1B. In mice and humans, alteration in Myo7a causes hereditary deafness.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The genomic structure of the gene defective in Usher syndrome type Ib (MYO7A)
Kelley PM, et al.
Genomics, 40(1), 73-79 (1997)
Structure and Regulation of the Movement of Human Myosin VIIA
Sakai T, et al.
The Journal of Biological Chemistry, 17587-17598 (2015)
Reduced climbing and increased slipping adaptation in cochlear hair cells of mice with Myo7a mutations
Kros CJ, et al.
Nature Neuroscience (2002)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service