SAB2103683

Anti-SPOPL antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 45 kDa
• species reactivity: human, rabbit, mouse, bovine, guinea pig, rat, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_001001664
• UniProt accession no.: Q6IQ16
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... SPOPL(339745)

Description

Immunogen

Synthetic peptide directed towards the middle region of human SPOPL

Biochem/physiol Actions

SPOPL belongs to the Tdpoz family. It contains 1 BTB (POZ) domain and 1 MATH domain. In complex with a cullin, SPOPL may act in ubiquitination and proteasomal degradation processes.

Sequence

Synthetic peptide located within the following region: WNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable