Skip to Content
Merck
All Photos(3)

Key Documents

SAB1402960

Sigma-Aldrich

Monoclonal Anti-VWF antibody produced in mouse

clone 1A11, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
R 8 833,72

R 8 833,72

List PriceR 9 014,00

Please contact Customer Service for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB7356


Select a Size

Change View
100 μG
R 8 833,72

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

R 8 833,72

List PriceR 9 014,00

Please contact Customer Service for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB7356

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1A11, monoclonal

form

buffered aqueous solution

mol wt

antigen ~56.14 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... VWF(7450)

General description

The glycoprotein encoded by this gene functions as both an antihemophilic factor carrier and a platelet-vessel wall mediator in the blood coagulation system. It is crucial to the hemostasis process. Mutations in this gene or deficiencies in this protein result in von Willebrand′s disease. An unprocessed pseudogene has been found on chromosome 22. (provided by RefSeq)

Immunogen

VWF (AAH22258.1, 1 a.a. ~ 273 a.a) full-length human protein.

Sequence
MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wei Deng et al.
Nature communications, 7, 12863-12863 (2016-09-28)
Mechanisms by which blood cells sense shear stress are poorly characterized. In platelets, glycoprotein (GP)Ib-IX receptor complex has been long suggested to be a shear sensor and receptor. Recently, a relatively unstable and mechanosensitive domain in the GPIbα subunit of
Bernardo J Krause et al.
Acta physiologica (Oxford, England), 227(3), e13328-e13328 (2019-06-10)
Foetal growth restriction (FGR) is associated with endothelial dysfunction and cardiovascular diseases in adult subjects. Early vascular remodelling and epigenetic changes occurring on key endothelial genes might precede this altered vascular function. Further, it has been proposed that oxidative stress
Emilio A Herrera et al.
The Journal of physiology, 595(4), 1077-1092 (2016-10-16)
Intrauterine growth restriction (IUGR) is associated with vascular dysfunction, oxidative stress and signs of endothelial epigenetic programming of the umbilical vessels. There is no evidence that this epigenetic programming is occurring on systemic fetal arteries. In IUGR guinea pigs we

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service