Skip to Content
Merck
All Photos(5)

Documents

HPA041309

Sigma-Aldrich

Anti-BICD1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Bicaudal d homolog 1 (Drosophila)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BICD1(636)

Related Categories

General description

The gene BICD1 (BICD cargo adaptor 1) is mapped to human chromosome 12p11. It is a coiled-coil protein.
BICD1 protein interacts with:

Immunogen

bicaudal D homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-BICD1 antibody produced in rabbit has been used in western blotting and immunofluorescence.

Biochem/physiol Actions

BICD1 (BICD cargo adaptor 1) is needed for transport of mRNA transcripts and retrograde trafficking of vesicles from the Golgi to the endoplasmic reticulum. It interacts with Rab6B (Ras-related protein) to control retrograde transport of cargo in neuronal cells. It plays an important role in dynein function by forming a complex with dynein–dynactin. Dynein is needed for mitosis, nuclear migration, mRNA movements and axonal and dendritic vesicles transport. BICD1 also controls PAR1 (protease-activated receptor 1)-G protein signaling and endocytosis. PAR1 is a G protein-associated receptor which has important roles in cancer, angiogenesis, inflammation and thrombosis. BICD1 polymorphism rs2630778 is associated with telomere shortening. In addition, it is one of the susceptibility gene for emphysema.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST81102

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Liujin Hou et al.
Frontiers in genetics, 13, 979001-979001 (2022-10-11)
Background: Colon cancer is the fifth most common cause of cancer-related death worldwide, and despite significant advances in related treatment, the prognosis of colon cancer patients remains poor. Objective: This study performs systematic bioinformatics analysis of prognostic-associated RNA processing factor
A novel protease-activated receptor-1 interactor, Bicaudal D1, regulates G protein signaling and internalization.
Swift S, et al.
The Journal of Biological Chemistry, 285, 11402-11410 (2010)
hTERT, BICD1 and chromosome 18 polymorphisms associated with telomere length affect kidney allograft function after transplantation.
Kloda K, et al.
Kidney & Blood Pressure Research, 40, 111-120 (2015)
Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors.
Terenzio M, et al.
The Embo Journal, 33, 1582-1598 (2014)
The Rab6 GTPase regulates recruitment of the dynactin complex to Golgi membranes.
Short B, et al.
Current Biology, 12, 1792-1792 (2002)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service