Skip to Content
Merck
All Photos(6)

Key Documents

HPA011929

Sigma-Aldrich

Anti-GOLM1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Golgi membrane protein 1, Anti-Golgi membrane protein GP73, Anti-Golgi phosphoprotein 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R 10 707,48

R 10 707,48

List PriceR 10 926,00

Please contact Customer Service for Availability


Select a Size

Change View
100 μL
R 10 707,48

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

R 10 707,48

List PriceR 10 926,00

Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
western blot: 0.04-0.4 μg/mL

immunogen sequence

VELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCE

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

General description

GOLM1 (Golgi membrane protein 1) is a resident, type II, 73kDa, Golgi-localized integral membrane protein consisting of an N-terminal transmembrane domain and a coiled-coil domain at the C-terminal luminal surface of the Golgi apparatus. It is expressed in the biliary epithelial cells of normal human tissues and sera of liver disease patients.

Immunogen

Golgi membrane protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The major role of GOLM1 (Golgi membrane protein 1) is directly correlated with the normal survival since, its controls the epithelial cell functioning such as in the kidney and liver. It regulates cell proliferation and apoptosis. It has been reported that GOLM1 functions as a diagnostic marker in liver disease and primary hepatic carcinoma.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71955

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ming-Chen Ba et al.
International journal of clinical and experimental pathology, 5(9), 874-881 (2012-11-03)
Hepatocellular carcinoma (HCC) is one of the most common malignant tumors, and its incidence has been increasing worldwide. Serum alpha-fetoprotein (AFP) levels and abdominal ultrasound have been widely used for diagnosis as well as surveillance of HCC. However, the sensitivity
Fang-Fang Cao et al.
Clinical laboratory, 60(4), 587-597 (2014-05-02)
Primary hepatic carcinoma (PHC) is currently one of the most common worldwide causes of cancer death. Golgi protein 73 (GP73) has been proposed as potential diagnostic marker. However, it is controversial because of inconsistent diagnostic accuracy in different studies. The
Yu-Long Zhang et al.
World journal of gastroenterology, 20(32), 11287-11296 (2014-08-30)
To investigate the roles of Golgi protein (GP) 73 in the regulation of cell proliferation and apoptosis. Stealth RNAi targeting GP73 gene sequence was used to silence its expression in Hep G2 cells and Bel7402 cells. Stealth RNAi effects were

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service