Skip to Content
Merck
All Photos(6)

Key Documents

HPA001804

Sigma-Aldrich

Anti-F13A1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Coagulation factor XIII A chain precursor antibody produced in rabbit, Anti-Coagulation factor XIIIa antibody produced in rabbit, Anti-Protein-glutamine γ-glutamyltransferase A chain antibody produced in rabbit, Anti-Transglutaminase A chain antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R 10 365,46

R 10 365,46

List PriceR 10 577,00

Please contact Customer Service for Availability


Select a Size

Change View
100 μL
R 10 365,46

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

R 10 365,46

List PriceR 10 577,00

Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

LNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... F13A1(2162)

General description

F13A1 (coagulation factor XIII A chain), a zymogen C, is a fibrin stabilizing glycoprotein. Coagulation factor XIII exists as a tetramer (A2B2) consisting of non-covalently bonded two A and two B subunits. F13A1 plays crucial role in termination of blood coagulation and and the fibrinolysis regulation.

Immunogen

Coagulation factor XIII A chain precursor recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

During blood coagulation, thrombin produces activated factor XIIIa (F13A1) from proenzyme, a transglutaminase, in presence of calcium ions and fibrin. Activated F13A1 accelerates the cross-linking reaction between fibrin monomers and between fibrin and A2- plasmin inhibitor. This cross linking reaction finally forms intermolecular ε-(γ-glutamyl) lysine bonds between the y chains and α chains of fibrin monomers followed by fibrin clot. It also catalyzes the cross-linking of fibronectin to fibrin or to collagen reaction which is an essential step for wound healing. Deficiency of F13A1 causes a severe lifelong bleeding tendency, defective wound healing, and habitual abortion.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84520

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Peter Almgren et al.
JCI insight, 2(21) (2017-11-03)
The secretion of insulin and glucagon from the pancreas and the incretin hormones glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic peptide (GIP) from the gastrointestinal tract is essential for glucose homeostasis. Several novel treatment strategies for type 2 diabetes (T2D) mimic
A Ichinose et al.
Proceedings of the National Academy of Sciences of the United States of America, 85(16), 5829-5833 (1988-08-01)
Factor XIII (plasma transglutaminase, fibrin stabilizing factor) is a glycoprotein that circulates in blood as a tetramer (a2b2) consisting of two a and two b subunits. The primary structures of the a and b subunits of human factor XIII have
P Board et al.
Blood, 80(4), 937-941 (1992-08-15)
Oligonucleotide primers have been designed for the amplification of all 15 exons of the human coagulation factor XIII A subunit gene. Each exon and its intron flanking regions has been amplified and sequenced from a patient with severe A subunit
A Azimi et al.
British journal of cancer, 110(10), 2489-2495 (2014-04-12)
Disseminated cutaneous malignant melanoma (CMM) is commonly unresponsive to standard chemotherapies, and there are as yet no predictive markers of therapy response. In the present study we collected fresh-frozen pretreatment lymph-node metastasis samples (n=14) from melanoma patients with differential response

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service