AV50121
Anti-JAM3 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Junctional adhesion molecule 3
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
28 kDa
species reactivity
human, guinea pig, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... JAM3(83700)
Related Categories
General description
The gene Junctional adhesion molecule 3 (JAM3; JAM-C) is mapped to human chromosme 11q25. JAM3 is a type I transmembrane glycoprotein and contains Ig-like domains. It belongs to Ig-superfamily called as JAMs. JAM3 is widely expressed with predominant expression in placenta, brain and kidney. It is also expressed in platelets but not in other blood cells.
Immunogen
Synthetic peptide directed towards the N terminal region of human JAM3
Application
Anti-JAM3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Junctional adhesion molecule 3 (JAM3; JAM-C) is a protein localized at the tight junctions of endothelial cells and acts as a receptor for another JAM molecule. JAM3 is involved in the regulation of vascular permeability, angiogenesis and nerve function. Deficient expression of JAM3 results in severe hydrocephalus and development of tumors in murine models. JAM3 is involved in lymphangiogenesis and nodal metastasis in non-small cell lung cancer. It is also associated with melanoma cell metastasis.
Sequence
Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
David A Leinster et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 27(10), 4244-4253 (2013-07-05)
Junctional adhesion molecule C (JAM-C) is a transmembrane protein with significant roles in regulation of endothelial cell (EC) functions, including immune cell recruitment and angiogenesis. As these responses are important in promoting tumor growth, the role of EC JAM-C in
Christoph Scheiermann et al.
Science (New York, N.Y.), 318(5855), 1472-1475 (2007-12-01)
JAM-C is an adhesion molecule that is expressed on cells within the vascular compartment and epithelial cells and, to date, has been largely studied in the context of inflammatory events. Using immunolabeling procedures in conjunction with confocal and electron microscopy
Harald F Langer et al.
Cancer research, 71(12), 4096-4105 (2011-05-20)
Hematogenous dissemination of melanoma is a life-threatening complication of this malignant tumor. Here, we identified junctional adhesion molecule-C (JAM-C) as a novel player in melanoma metastasis to the lung. JAM-C expression was identified in human and murine melanoma cell lines
Lena Wyss et al.
PloS one, 7(9), e45619-e45619 (2012-10-03)
The junctional adhesion molecule (JAM)-C is a widely expressed adhesion molecule regulating cell adhesion, cell polarity and inflammation. JAM-C expression and function in the central nervous system (CNS) has been poorly characterized to date. Here we show that JAM-C(-/-) mice
M P Arrate et al.
The Journal of biological chemistry, 276(49), 45826-45832 (2001-10-09)
We have identified a third member of the junctional adhesion molecule (JAM) family. At the protein level JAM3 displays 36 and 32% identity to JAM2 and JAM1, respectively. The coding region is distributed over 9 exons and maps to chromosome
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service