Skip to Content
Merck
All Photos(1)

Key Documents

AV49119

Sigma-Aldrich

Anti-UGT3A2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-MGC119426, Anti-MGC119429, Anti-UDP glycosyltransferase 3 family, polypeptide A2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R 7 387,24

R 7 387,24

List PriceR 7 538,00

Please contact Customer Service for Availability


Select a Size

Change View
100 μL
R 7 387,24

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

R 7 387,24

List PriceR 7 538,00

Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

59 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... UGT3A2(167127)

Immunogen

Synthetic peptide directed towards the N terminal region of human UGT3A2

Application

Anti-UGT3A2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Biochem/physiol Actions

UDP glycosyltransferase 3 family, polypeptide A2 (UGT3A2) belongs to UDP glycosyltransferase family of enzymes that are involved in the metabolism of small lipophilic compounds. UGT3A2 adds sugars from UDP glucose and UDP xylose to a broad range of substrates to enhance their excretion.[1][2]

Sequence

Synthetic peptide located within the following region: HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Peter I MacKenzie et al.
Molecular pharmacology, 79(3), 472-478 (2010-11-23)
The human UDP glycosyltransferase (UGT) 3A family is one of three families involved in the metabolism of small lipophilic compounds. Members of these families catalyze the addition of sugar residues to chemicals, which enhances their excretion from the body. The
Robyn Meech et al.
The Journal of biological chemistry, 287(29), 24122-24130 (2012-05-25)
Recent studies in this laboratory characterized the UGT3A family enzymes, UGT3A1 and UGT3A2, and showed that neither uses the traditional UDP-glycosyltransferase UGT co-substrate UDP-glucuronic acid. Rather, UGT3A1 uses GlcNAc as preferred sugar donor and UGT3A2 uses UDP-Glc. The enzymatic characterization

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service