Skip to Content
Merck
All Photos(1)

Key Documents

AV37341

Sigma-Aldrich

Anti-YAF2 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R 9 560,88

R 9 560,88

List PriceR 9 756,00

Please contact Customer Service for Availability


Select a Size

Change View
100 μL
R 9 560,88

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

R 9 560,88

List PriceR 9 756,00

Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

20 kDa

species reactivity

human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

mouse ... YAF2(67057)

General description

YY1-associated factor 2 (YAF2) interacts with the zinc finger protein YY1 and promotes it′s proteolytic cleavage by m-calpain. YAF2 has Los been shown to bind to MYC and inhibits MYC-mediated transactivation. [1]

Immunogen

Synthetic peptide directed towards the middle region of mouse YAF2

Biochem/physiol Actions

Yaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling.

Sequence

Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Britta Mädge et al.
Cancer letters, 193(2), 171-176 (2003-04-23)
The proto-oncogenes of the myelocytomatosis viral oncogene homolog (MYC) family, including MYC, MYCN and MYCL, encode nuclear proteins that act as transcription factors. The Myc protein is the best studied member of this family and is involved in cell cycle

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service