Skip to Content
Merck
All Photos(2)

Documents

AV03005

Sigma-Aldrich

Anti-CDK6 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Cyclin-dependent kinase 6, Anti-MGC59692, Anti-PLSTIRE

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDK6(1021)

Immunogen

Synthetic peptide directed towards the C terminal region of human CDK6

Application

Anti-CDK6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.625 μg/ml.

Biochem/physiol Actions

CDK6 is a D-type cyclin dependent kinase that initiates the phosphorylation of Rb tumor suppressor protein. In selected cell types the cyclin D/CDK6 activity is essential for cell proliferation. In collaboration with pRb, CDK6 has been discovered to play an important role in cell differentiation and in maintaining the cell cycle exit during differentiation.

Target description

CDK6 is a cyclin-dependent kinase important in regulating cell cycle progression specifically transitioning from G1 to G1/S phase.

Sequence

Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Martha J Grossel et al.
Cell cycle (Georgetown, Tex.), 5(3), 266-270 (2006-01-18)
Over ten years ago, cdk6 was identified as a new member in a family of vertebrate cdc-2 related kinases. This novel kinase was found to partner with the D-type cyclins and to possess pRb kinase activity in vitro. Recently, several
Naoko Ohtani et al.
The journal of medical investigation : JMI, 51(3-4), 146-153 (2004-10-06)
The p16INK4a tumor suppressor protein functions as an inhibitor of CDK4 and CDK6, the D-type cyclin-dependent kinases that initiate the phosphorylation of the retinoblastoma tumor suppressor protein, RB. Thus, p16INK4a has the capacity to arrest cells in the G1-phase of
Katarzyna Kozar et al.
Cell cycle (Georgetown, Tex.), 4(3), 388-391 (2005-03-02)
D-type cyclins (cyclin D1, D2 and D3) and their associated cyclin-dependent kinases CDK4 and CDK6 were thought to represent important, perhaps essential components of the core cell cycle apparatus. However, recent analyses of mice lacking D-cyclins, or CDK4 and CDK6

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service